e/Tx2-6

Information
has gloss	eng: Tx2-6 is a toxin found in the venom of the Brazilian wandering spider, Phoneutria nigriventer (Keys). It is a peptide of 48 residues, molecular weight 5291.3. This peptide is cleaved from a longer precursor with a signal peptide and a glutamine-rich propeptide. Its sequence is MKVAILFLSILVLAVASESIEESRDDFAVEELGR-ATCAGQDQPCKETCDCCGERGECVCGGPCICRQGYFWIAWYKLANCKK, where hyphen marks the beginning of the processed peptide. It can cause priapism. Tests on rats indicate that the toxin causes nitric oxide release, and its effect on erection is blocked by the nitric oxide synthase inhibitor L-NAME. However, it fully restored erectile function in rats developing hypertension due to injection of deoxycorticosterone acetate. A study is underway at the Medical College of Georgia looking at possible uses for the chemical in erectile dysfunction medication.
lexicalization	eng: Tx2-6
instance of	(noun) a poisonous substance produced during the metabolism and growth of certain microorganisms and some higher plant and animal species toxin